AIM
To study the BLAST similarity search Tool.
INTRODUCTION
The Blast tool finds regions of local similarity between sequences. The program compares nucleotide (or) protein sequences to sequence Data base and calculates the statistical significance of matches. Blast can be used to infer functional and evolutionary relationships between sequences and also helps to identify members of gene families.
TYPES OF BLAST SEARCH
NUCLETIDE DATABASES
(1) MegaBLAST
It quickly searches for highly similar sequences with large queries.
(2) Discontiguous MegaBLAST
It quickly search for divergent sequences.
(3) BLAST n
It is a nucleotide-nucleotide BLAST which searches for short and nearly exact matches.
PROTEIN
(1) BLAST p
It is a protein-protein BLAST which searches for exact matches.
(2) PSI-BLAST
Position specific Iterated BLAST
(3) PHI-BLAST
Pattern Hit Initiative BLAST
(1) BLAST x
Translated DNA query with protein Database
(2) tBLASTn
Compares protein query with translated DNA Database.
(3) tBLASTx
Compares translated DNA query with translated DNA database.
Specialised BLAST Program
(1) Geo BLAST
It searches for gene expression Data.
(2) bl2seq
Aligns two sequences.
(3) Ig BLAST
It is an immunoglobin protein.
EXPECTATION VALUE
The expectation value (E) is a parameter that describes the number of Hits one can expect to see just by chance. When searching a Database of a particular size. It decreases exponentially with the score (S) that is assigned to a match between two sequences essentially the e value describes the random Back ground noise that exists for matches between sequences.
For example : An E value of one assigned to a hit can be interpreted as meaning that the Database of current size one might expect to see one match. With a similar sore simply by chance. This means that lower the E value (or) the closer it is to zero then it is a significant match.
ALGORITHM
(1) Go to NCBI Homepage and click BLAST.
(2) Then select the type of BLAST search you want.
(3) Obtain the FASTA format of the given query.
(4) After that paste your sequence in BLAST program.
(5) Select the appropriate parameters (if any).
(6) Click Format (or) BLAST to perform search operation.
(7) You will get results displayed based on the E value and score.
(8) Interpretation of results to get significant matchesQUERY SEQUENCE
>gi|205943662|gb|ACI04728.1| lysin [Haliotis sorenseni]
EVALKVQIIAGFDRTLVKWLRTHGGTLSHVQKKALYFVNRRYMQTH
University of Perpetual Help System Dalta Top Medical College in Philippines
ReplyDeleteUniversity of Perpetual Help System Dalta (UPHSD), is a co-education Institution of higher learning located in Las Pinas City, Metro Manila, Philippines. founded in 1975 by Dr. (Brigadier) Antonio Tamayo, Dr. Daisy Tamayo, and Ernesto Crisostomo as Perpetual Help College of Rizal (PHCR). Las Pinas near Metro Manila is the main campus. It has nine campuses offering over 70 courses in 20 colleges.
UV Gullas College of Medicine is one of Top Medical College in Philippines in Cebu city. International students have the opportunity to study medicine in the Philippines at an affordable cost and at world-class universities. The college has successful alumni who have achieved well in the fields of law, business, politics, academe, medicine, sports, and other endeavors. At the University of the Visayas, we prepare students for global competition.